PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10024866m
Common NameEUTSA_v10024866mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 540aa    MW: 60113.7 Da    PI: 6.4295
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10024866mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.42.4e-26187240155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+ Wt eLH++F+ av++L G ekA+Pk+il+lm+v+ Lt+e+v+SHLQk+R+
  Thhalv10024866m 187 KPRVLWTRELHNKFLAAVDHL-GVEKAVPKKILDLMNVEKLTRENVASHLQKFRS 240
                      79*******************.********************************7 PP

2Response_reg875.3e-29161241109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+++ +++l+++l + +y +v+++d+++ al+ll+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++++++ + +k 
  Thhalv10024866m  16 VLAVDDDQTCLRILETLLHRCQY-HVTTTDQAQTALKLLRENKnkFDLVISDVDMPDMDGFKLLELVGL-EMDLPVIMLSAHSDPKYVMKGVKH 107
                      799********************.***************888888*******************87754.558********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ +eel +
  Thhalv10024866m 108 GACDYLLKPVRIEELKN 124
                      **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.0E-4213159No hitNo description
SuperFamilySSF521721.2E-3513132IPR011006CheY-like superfamily
SMARTSM004482.3E-3314126IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.01915130IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.4E-2616124IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.62E-2917129No hitNo description
PROSITE profilePS5129413.57184243IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-27184245IPR009057Homeodomain-like
SuperFamilySSF466893.14E-19185244IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-25187240IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MTVEQDLDQF PVGMRVLAVD DDQTCLRILE TLLHRCQYHV TTTDQAQTAL KLLRENKNKF  60
DLVISDVDMP DMDGFKLLEL VGLEMDLPVI MLSAHSDPKY VMKGVKHGAC DYLLKPVRIE  120
ELKNIWQHVV RKGKFKKMKS SLSNGESEGN SDQNGVKANR KRKDQFEEEE EDEERGIEND  180
DPTAQKKPRV LWTRELHNKF LAAVDHLGVE KAVPKKILDL MNVEKLTREN VASHLQKFRS  240
ALKKITNETN QQANMAAMDS HFMQMSSLKG LGGFHHHRPI PLGSGQFHGG AATMRQYPSN  300
RTLGRLNSLA GMFPHVSSSL PRNHNDGGGY ILQGLPIPPL QGLHIENNKT FPSFTSQQSS  360
PVVLEGHLQS SSPSSIPGFS PHLEMNKRLE DWSNAVLSST NIPQSGAHSK PDALEWNQFC  420
DSASPLMNTN VDTNPTSFCR NTDFGQSNSA QTEIFNPLQI KQQYANNLGP MTDAQQLTSN  480
NTKEGLVMGQ QKVESGFMAS DAGSLDDIVN SMMTQEQSQA DFGEGDLGFG WFNSHRTCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-32183246164ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00072SELEXTransfer from AT4G31920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3535330.0AK353533.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-50-C17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412536.10.0hypothetical protein EUTSA_v10024866mg
SwissprotO493970.0ARR10_ARATH; Two-component response regulator ARR10
TrEMBLV4MC700.0V4MC70_EUTSA; Uncharacterized protein
STRINGBra023972.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31920.10.0response regulator 10